PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR10G08960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family GATA
Protein Properties Length: 547aa    MW: 60065 Da    PI: 9.4004
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR10G08960.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.29.3e-1871105135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C++Cg+tkTp WR++pdg +tLCnaCG++yr++g+
  LPERR10G08960.1  71 CRHCGATKTPWWRSDPDGRRTLCNACGVRYRSRGR 105
                      ********************************996 PP

2GATA66.13.6e-21248282135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C++CgttkTp+WR+gpdg +tLCnaCG+yyr +g+
  LPERR10G08960.1 248 CRHCGTTKTPQWRNGPDGRRTLCNACGVYYRIHGR 282
                      *********************************97 PP

3GATA62.26.3e-20368401134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      C++Cg t+Tp+WRrgpdg +tLCnaCG++yr+ +
  LPERR10G08960.1 368 CRHCGKTETPQWRRGPDGARTLCNACGVRYRSGR 401
                      *******************************987 PP

4GATA40.73.2e-13483517135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C++Cg tkT +WR+gpd  ++LC +CG +yr+ +l
  LPERR10G08960.1 483 CAHCGRTKTWQWRSGPDSGRKLCDPCGKRYRSGRL 517
                      ****************77777**********9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011413.42865108IPR000679Zinc finger, GATA-type
SMARTSM004016.0E-1665120IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.85E-1568129No hitNo description
Gene3DG3DSA:3.30.50.102.2E-1470106IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.08E-1370120No hitNo description
PfamPF003203.0E-1571105IPR000679Zinc finger, GATA-type
PROSITE patternPS0034407196IPR000679Zinc finger, GATA-type
SMARTSM004012.6E-19242293IPR000679Zinc finger, GATA-type
PROSITE profilePS5011416.421242304IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.28E-16244298No hitNo description
Gene3DG3DSA:3.30.50.108.4E-17246283IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.53E-16247294No hitNo description
PROSITE patternPS003440248273IPR000679Zinc finger, GATA-type
PfamPF003207.1E-19248282IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.61E-15361423No hitNo description
SMARTSM004012.5E-17362416IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.835362398IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.7E-15366399IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.26E-14367416No hitNo description
PfamPF003208.4E-18368401IPR000679Zinc finger, GATA-type
PROSITE patternPS003440368393IPR000679Zinc finger, GATA-type
SMARTSM004017.0E-6477531IPR000679Zinc finger, GATA-type
PROSITE profilePS501149.42477513IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.14E-9478528No hitNo description
Gene3DG3DSA:3.30.50.101.2E-7479514IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.48E-8482531No hitNo description
PfamPF003202.9E-11483517IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MVVAVDGLYD DASAALVDEI FNGGDLHALQ DDAELDVAAR GGGDAGETKG KEVEPERPSN  60
KAATAAARLQ CRHCGATKTP WWRSDPDGRR TLCNACGVRY RSRGRLLPEY RPLNSPAFSP  120
EVHSNKHRRV VELRRRRPEP PSSVPAPLSP PPPAVDALRD DAIADELLDG GDFQALLDGT  180
LQGLDVAASG GEAKEGEEEE LEWLSNKDAF PEVETISPPP ASTVKAQNKT TKPARTARRC  240
RPATGLKCRH CGTTKTPQWR NGPDGRRTLC NACGVYYRIH GRLLPEYRPL NSPTLLFAEL  300
PSNRHRLVLQ LRRPCAVDDE EEELEWLSNK DAFPTLETMA TAPPPPLVAE HRAKKAARRR  360
RPPPPLRCRH CGKTETPQWR RGPDGARTLC NACGVRYRSG RLFPEYRPLN SPTFSPELHS  420
NIHRRVLLLR HHPSPSPPPP PPAVPTPTPA ATTPAATHSK KPLRCKQERP ASANLAVAAA  480
RQCAHCGRTK TWQWRSGPDS GRKLCDPCGK RYRSGRLVLE CRPLNGPTFL PEMHSGMSFA  540
AGGGGDR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613898.12e-43PREDICTED: siderophore biosynthesis regulatory protein URBS1-like
SwissprotQ9FH577e-28GATA5_ARATH; GATA transcription factor 5
TrEMBLA0A0D9XKC00.0A0A0D9XKC0_9ORYZ; Uncharacterized protein
STRINGBGIOSGA031769-PA5e-43(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP157091414
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.15e-27GATA transcription factor 1